![Western Blot: CTHRC1 Antibody [NBP2-31797] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CTHRC1-Antibody-Western-Blot-NBP2-31797-img0004.jpg "Western Blot: CTHRC1 Antibody [NBP2-31797] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CTHRC1 Antibody - BSA Free (NBP2-31797) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CTHRC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CTHRC1 Antibody (NBP2-31797)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human pancreas shows low positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/CTHRC1-Antibody-Immunohistochemistry-Paraffin-NBP2-31797-img0008.jpg "Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human pancreas shows low positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CTHRC1-Antibody-Immunohistochemistry-Paraffin-NBP2-31797-img0005.jpg "Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/CTHRC1-Antibody-Immunohistochemistry-Paraffin-NBP2-31797-img0006.jpg "Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.")
![Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CTHRC1-Antibody-Immunohistochemistry-Paraffin-NBP2-31797-img0007.jpg "Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Western Blot ROR2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ROR2_AF2064_Western_Blot_11177.jpg)
![Simple Western ROR2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ROR2_AF2064_Simple_Western_16763.jpg)
![Western Blot ROR2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2064_human-ror2-affinity-purified-polyclonal-ab-western-blot-121220259313319.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images/af1927_human-bmp-1-pcp-affinity-purified-polyclonal-ab-western-blot-1212202575044.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Western Blot DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Western_Blot_16723.jpg)
![Simple Western DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_17635.jpg)
![Immunohistochemistry DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_7152.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")