CTDSP1 Antibody - BSA Free

Western Blot: CTDSP1 Antibody [NBP2-87226] - WB Suggested Anti-CTDSP1 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole CellCTDSP1 is supported by BioGPS gene expression data to be expressed in HepG2

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CTDSP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CTDSP1 Antibody - BSA Free (NBP2-87226) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTDSP1. Peptide sequence: KQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEID The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTDSP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CTDSP1 Antibody - BSA Free

• carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
• CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 1
• NIF3
• NLI-IF
• NLIIFEC 3.1.3.16
• NLI-interacting factor 3
• SCP1Nuclear LIM interactor-interacting factor 3
• Small CTD phosphatase 1
• Small C-terminal domain phosphatase 1

Background

Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in theC-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase IItranscription, possibly by controlling the transition from initiation/capping to processive transcript elongation.Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronalcells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTDSP1