CSMD3 Antibody - BSA Free

Staining of human cell line HAP1 shows localization to plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CSMD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CSMD3 Antibody - BSA Free (NBP3-24767) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CSMD3 using the following amino acid sequence: SAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSMD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CSMD3 Antibody - BSA Free

• CSMD3
• CSMD-3
• CUB and sushi domain-containing protein 3
• CUB and Sushi multiple domains 3
• KIAA1894
• KIAA1894CUB and sushi multiple domains protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSMD3