CRYBA1 Antibody

Images

 
Western Blot: CRYBA1 Antibody [NBP1-52907] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRYBA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CRYBA1(crystallin, beta A1) The peptide sequence was selected from the N terminal of CRYBA1. Peptide sequence METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRYBA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CRYBA1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CRYBA1 Antibody

  • CRYB1beta-crystallin A3
  • crystallin, beta A1
  • crystallin, beta A3
  • eye lens structural protein

Background

Crystallins are the dominant structural components of the vertebrate eye lens. Defects in CRYBA1 are the cause of congenital zonular cataract with sutural opacities (CCZS).Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta acidic group member, encodes two proteins (crystallin, beta A3 and crystallin, beta A1) from a single mRNA, the latter protein is 17 aa shorter than crystallin, beta A3 and is generated by use of an alternate translation initiation site. Deletion of exons 3 and 4 causes the autosomal dominant disease 'zonular cataract with sutural opacities'. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001415-M02
Species: Hu
Applications: WB, ELISA
H00001414-M03
Species: Hu
Applications: WB, ELISA
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
31310002
Species: Hu
Applications: WB, ELISA
NBP1-32557
Species: Hu
Applications: WB
NBP1-32741
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-49196
Species: Hu
Applications: IHC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-84375
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58660
Species: Hu
Applications: IHC-P
NBP2-58661
Species: Hu
Applications: IHC-P
MAB5695
Species: Hu, Mu
Applications: WB
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-52907
Species: Hu
Applications: WB

Publications for CRYBA1 Antibody (NBP1-52907) (0)

There are no publications for CRYBA1 Antibody (NBP1-52907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRYBA1 Antibody (NBP1-52907) (0)

There are no reviews for CRYBA1 Antibody (NBP1-52907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRYBA1 Antibody (NBP1-52907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRYBA1 Products

Bioinformatics Tool for CRYBA1 Antibody (NBP1-52907)

Discover related pathways, diseases and genes to CRYBA1 Antibody (NBP1-52907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRYBA1 Antibody (NBP1-52907)

Discover more about diseases related to CRYBA1 Antibody (NBP1-52907).
 

Pathways for CRYBA1 Antibody (NBP1-52907)

View related products by pathway.

PTMs for CRYBA1 Antibody (NBP1-52907)

Learn more about PTMs related to CRYBA1 Antibody (NBP1-52907).

Blogs on CRYBA1

There are no specific blogs for CRYBA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRYBA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYBA1
Uniprot