CRY2 Antibody (3H4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: CRY2 Antibody (3H4) [H00001408-M03] - Analysis of monoclonal antibody to CRY2 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: CRY2 Antibody (3H4) [H00001408-M03] - Detection limit for recombinant GST tagged CRY2 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3H4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CRY2 Antibody (3H4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CRY2 (NP_066940.1, 141 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG
• Specificity: CRY2 - cryptochrome 2 (photolyase-like) (3H4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CRY2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRY2 Antibody (3H4) - Azide and BSA Free

• CRY2
• cryptochrome 2 (photolyase-like)
• cryptochrome-2
• FLJ10332
• growth-inhibiting protein 37
• HCRY2
• KIAA0658
• PHLL2

Background

Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK NPAS2-ARNTL E box-mediatedtranscription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has nophotolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. Mayinhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRY2
• Entrez:
  • 1408(Human)
• Uniprot:
  • NP_066940(Human)