CRX/CORD2 Antibody (2F12)

Images

 
Western Blot: CRX/CORD2 Antibody (2F12) [H00001406-M03] - Analysis of CRX expression in PC-12 (Cat # L012V1).
ELISA: CRX/CORD2 Antibody (2F12) [H00001406-M03] - Detection limit for recombinant GST tagged CRX is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
2F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRX/CORD2 Antibody (2F12) Summary

Immunogen
CRX (NP_000545, 1 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
Specificity
CRX (2F12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00001406-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRX/CORD2 Antibody (2F12)

  • cone-rod homeobox
  • CORD2
  • CRDcone-rod homeobox protein
  • CRX
  • LCA7
  • LCA7orthodenticle homeobox 3
  • OTX3

Background

The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2945
Species: Hu
Applications: WB
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-22568
Species: Hu
Applications: IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56113
Species: Hu
Applications: IHC-P
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00001406-M03
Species: Hu, Rt
Applications: WB, ELISA

Publications for CRX/CORD2 Antibody (H00001406-M03)(1)

Reviews for CRX/CORD2 Antibody (H00001406-M03) (0)

There are no reviews for CRX/CORD2 Antibody (H00001406-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRX/CORD2 Antibody (H00001406-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRX/CORD2 Products

Bioinformatics Tool for CRX/CORD2 Antibody (H00001406-M03)

Discover related pathways, diseases and genes to CRX/CORD2 Antibody (H00001406-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRX/CORD2 Antibody (H00001406-M03)

Discover more about diseases related to CRX/CORD2 Antibody (H00001406-M03).
 

Pathways for CRX/CORD2 Antibody (H00001406-M03)

View related products by pathway.

PTMs for CRX/CORD2 Antibody (H00001406-M03)

Learn more about PTMs related to CRX/CORD2 Antibody (H00001406-M03).

Blogs on CRX/CORD2

There are no specific blogs for CRX/CORD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRX/CORD2 Antibody (2F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRX
Entrez
OMIM
Uniprot