CRLR Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CALCRL |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CRLR Antibody
Background
Calcitonin receptor-like receptor (CRLR) is an Adrenomedullin Receptor that requires two additional proteins to function: a chaperone protein RAMP (receptor activity modifying protein) and the component protein RCP. The function of CRLR depends on its interaction with RAMP. When coexpressed with RAMP1, CRLR acts as a receptor for calcitonin gene-related peptide (CGRP). In contrast, when CRLR is coexpressed with either RAMP2 or RAMP3, it acts as a receptor for adrenomedullin. Activation of the receptor leads to an increase in intracellular cyclic AMP. CRLR mediates the vasorelaxation of arteries, suggesting a potential role for the receptor in reaction to injury, particularly in the treatment of pulmonary hypertension. CRLR expression has been reported in brain, lung, blood vessel, liver, and intestinal tract. ESTs have been isolated from B-Cell/lung/testis, bone marrow, embryo, lung, and synovium libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Publications for CRLR Antibody (NBP2-58137) (0)
There are no publications for CRLR Antibody (NBP2-58137).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRLR Antibody (NBP2-58137) (0)
There are no reviews for CRLR Antibody (NBP2-58137).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CRLR Antibody (NBP2-58137) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CRLR Products
Bioinformatics Tool for CRLR Antibody (NBP2-58137)
Discover related pathways, diseases and genes to CRLR Antibody (NBP2-58137). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CRLR Antibody (NBP2-58137)
Discover more about diseases related to CRLR Antibody (NBP2-58137).
| | Pathways for CRLR Antibody (NBP2-58137)
View related products by pathway.
|
PTMs for CRLR Antibody (NBP2-58137)
Learn more about PTMs related to CRLR Antibody (NBP2-58137).
| | Research Areas for CRLR Antibody (NBP2-58137)
Find related products by research area.
|
Blogs on CRLR