CRLR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CALCRL Antibody [NBP2-58137] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRLR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALCRL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRLR Recombinant Protein Antigen (NBP2-58137PEP)

Reactivity Notes

Mouse (86%), Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CRLR Antibody

  • calcitonin gene-related peptide type 1 receptor
  • calcitonin receptor-like
  • CALCRL
  • CGRP type 1 receptor
  • CGRPR
  • CGRPRCRLRCalcitonin receptor-like receptor
  • CRLR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6500
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF6428
Species: Hu
Applications: IHC, WB
AF6108
Species: Hu
Applications: IHC
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF4875
Species: Hu
Applications: WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-40840
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6517
Species: Hu
Applications: WB
NBP1-77129
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90231
Species: Hu
Applications: IHC, IHC-P
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP1-84495
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P

Publications for CRLR Antibody (NBP2-58137) (0)

There are no publications for CRLR Antibody (NBP2-58137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRLR Antibody (NBP2-58137) (0)

There are no reviews for CRLR Antibody (NBP2-58137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CRLR Antibody (NBP2-58137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRLR Products

Bioinformatics Tool for CRLR Antibody (NBP2-58137)

Discover related pathways, diseases and genes to CRLR Antibody (NBP2-58137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRLR Antibody (NBP2-58137)

Discover more about diseases related to CRLR Antibody (NBP2-58137).
 

Pathways for CRLR Antibody (NBP2-58137)

View related products by pathway.

PTMs for CRLR Antibody (NBP2-58137)

Learn more about PTMs related to CRLR Antibody (NBP2-58137).
 

Research Areas for CRLR Antibody (NBP2-58137)

Find related products by research area.

Blogs on CRLR

There are no specific blogs for CRLR, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRLR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCRL