CRISPLD2 Antibody

Images

 
Western Blot: CRISPLD2 Antibody [NBP1-69620] - This Anti-CRISPLD2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.
Western Blot: CRISPLD2 Antibody [NBP1-69620] - 1. Human Lung Fibroblast cells (40ug) 2. Mouse lung cells (40ug) Primary dilution: 1 : 2000 Secondary Antibody: Anti-rabbit IgG horseradish peroxidase Secondary dilution: 1 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRISPLD2 Antibody Summary

Immunogen
Synthetic peptides corresponding to CRISPLD2(cysteine-rich secretory protein LCCL domain containing 2) The peptide sequence was selected from the N terminal of CRISPLD2. Peptide sequence MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRISPLD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CRISPLD2 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CRISPLD2 Antibody

  • CRISP11
  • CRISP-11
  • Cysteine-rich secretory protein 11
  • cysteine-rich secretory protein LCCL domain containing 2
  • cysteine-rich secretory protein LCCL domain-containing 2
  • DKFZP434B044
  • LCCL domain containing cysteine-rich secretory protein 2
  • LCCL domain-containing cysteine-rich secretory protein 2
  • LCRISP2
  • MGC74865

Background

CRISPLD2 is a novel NSCLP candidate gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5117
Species: Hu
Applications: WB, IHC
870-LP/CF
Species: Hu
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-12553
Species: Hu
NBP1-84413
Species: Hu
Applications: IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54851
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
AF4929
Species: Mu
Applications: WB
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-82445
Species: Hu
Applications: WB, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for CRISPLD2 Antibody (NBP1-69620) (0)

There are no publications for CRISPLD2 Antibody (NBP1-69620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRISPLD2 Antibody (NBP1-69620) (0)

There are no reviews for CRISPLD2 Antibody (NBP1-69620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRISPLD2 Antibody (NBP1-69620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRISPLD2 Products

Bioinformatics Tool for CRISPLD2 Antibody (NBP1-69620)

Discover related pathways, diseases and genes to CRISPLD2 Antibody (NBP1-69620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRISPLD2 Antibody (NBP1-69620)

Discover more about diseases related to CRISPLD2 Antibody (NBP1-69620).
 

Pathways for CRISPLD2 Antibody (NBP1-69620)

View related products by pathway.

Blogs on CRISPLD2

There are no specific blogs for CRISPLD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRISPLD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRISPLD2
Uniprot