CRISP-1 Antibody


Immunohistochemistry-Paraffin: CRISP-1 Antibody [NBP1-89226] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: CRISP-1 Antibody [NBP1-89226] - Staining of human epididymis shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CRISP-1 Antibody [NBP1-89226] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: CRISP-1 Antibody [NBP1-89226] - Staining in human epididymis and endometrium tissues using anti-CRISP1 antibody. Corresponding CRISP1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CRISP-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYYDEYFDCDIQVHYLGCNHSTTILFCKATCLC
Specificity of human CRISP-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRISP-1 Protein (NBP1-89226PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CRISP-1 Antibody

  • Acidic epididymal glycoprotein homolog
  • acidic epididymal glycoprotein-like 1
  • AEGL1
  • AEG-related protein
  • ARPAEG-like protein
  • CRISP1
  • CRISP-1
  • cysteine-rich secretory protein 1
  • cysteine-rich secretory protein-1 delta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P

Publications for CRISP-1 Antibody (NBP1-89226) (0)

There are no publications for CRISP-1 Antibody (NBP1-89226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRISP-1 Antibody (NBP1-89226) (0)

There are no reviews for CRISP-1 Antibody (NBP1-89226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRISP-1 Antibody (NBP1-89226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CRISP-1 Products

Bioinformatics Tool for CRISP-1 Antibody (NBP1-89226)

Discover related pathways, diseases and genes to CRISP-1 Antibody (NBP1-89226). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRISP-1 Antibody (NBP1-89226)

Discover more about diseases related to CRISP-1 Antibody (NBP1-89226).

Pathways for CRISP-1 Antibody (NBP1-89226)

View related products by pathway.

PTMs for CRISP-1 Antibody (NBP1-89226)

Learn more about PTMs related to CRISP-1 Antibody (NBP1-89226).

Blogs on CRISP-1

There are no specific blogs for CRISP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CRISP-1 Antibody and receive a gift card or discount.


Gene Symbol CRISP1