Home » CRIF1 » CRIF1 Antibodies » CRIF1 Antibody

CRIF1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CRIF1 Antibody [NBP2-87211] - WB Suggested Anti-GADD45GIP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellGADD45GIP1 is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: CRIF1 Antibody [NBP2-87211] - WB Suggested Anti-GADD45GIP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellGADD45GIP1 is supported by BioGPS gene expression data to be expressed in HeLa

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CRIF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of CRIF1. Peptide sequence: SLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GADD45GIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRIF1 Antibody

  • CKBBP2
  • CKII beta-associating protein
  • CR6 interacting factor 1
  • CRIF1p53-responsive gene 6 protein
  • growth arrest and DNA damage-inducible proteins-interacting protein 1
  • growth arrest and DNA-damage-inducible, gamma interacting protein 1
  • MGC4667
  • MGC4758
  • papillomavirus L2 interacting nuclear protein 1
  • Papillomavirus L2-interacting nuclear protein 1
  • Plinp1
  • PLINP-1CKII beta binding protein 2
  • PRG6CR6-interacting factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NAC1 Antibody
[Unconjugated]
AF8375
Western blot shows lysates of BG01V human embryonic stem cells. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NAC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8375) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for NAC1 at approximately 72 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NAC1 was detected in immersion fixed paraffin-embedded sections of human cervical cancer tissue using Sheep Anti-Human NAC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8375) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei in cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and NAC1 knockout HeLa cell line (KO). PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NAC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8375) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for NAC1 at approximately 68 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, KO, WB
GADD45G Antibody
(OTI2F12)
NBP2-45807
Immunocytochemistry/Immunofluorescence: GADD45G Antibody (OTI2F12) [NBP2-45807] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY GADD45G.
Immunohistochemistry: GADD45G Antibody (OTI2F12) [NBP2-45807] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: GADD45G Antibody (OTI2F12) [NBP2-45807] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Nrf2 Antibody [NBP1-32822] - Untreated (-) and treated (+) RAW264.7 whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Nrf2 Antibody [NBP1-32822] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(4 Reviews)
(43 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
MYD118 Antibody
NBP3-12326
Western Blot: MYD118 Antibody [NBP3-12326] - 1) GADD45B positive control, 2) Raw Cells. 1:500 antibody dilution. Apparent MW is 21 KDa.
Immunohistochemistry-Paraffin: MYD118 Antibody [NBP3-12326] - Rat Liver. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 10X mangification.
Immunohistochemistry-Paraffin: MYD118 Antibody [NBP3-12326] - Rat Liver. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40 X mangification.
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Histone
Deacetylase 4/HDAC4 A ...
NBP2-22151
Immunohistochemistry: Histone Deacetylase 4/HDAC4 Antibody [NBP2-22151] - Analysis of HDAC4 in mouse pancreas.
Western Blot: Histone Deacetylase 4/HDAC4 Antibody [NBP2-22151] - Analysis of HDAC4 in NIH/3T3 lysate.
Western Blot: Histone Deacetylase 4/HDAC4 Antibody [NBP2-22151] - Expression of HDACs in murine optic nerve. Western blot analysis of HDAC proteins in E16, P5 and P30 murine optic nerve was performed to check the specificity of the antibodies used for the study. Blots were normalized to beta-TUBULIN. Densitometric graphs for each HDAC panel show quantification of protein levels expressed as fold-change from E16. p < 0.05 was considered statistically significant and represented by a single *, whereas p < 0.005 is represented by **. Bars show mean +/- SEM of three samples per timepoint. Note that the apparent increase in band intensities for some P5 samples reflect increased protein loading in those lanes. Image collected and cropped by CiteAb from the following publication (http://bmcdevbiol.biomedcentral.com/articles/10.1186/1471-213X-14-30), licensed under a CC-BY licence.
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
GADD45 alpha
Antibody
AF5510
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected or transfected with full length human GADD45 alpha . PVDF membrane was probed with 1 µg/mL Human GADD45 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5510) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band for GADD45 alpha was detected at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Casein Kinase 2
alpha Antibody (84472 ...
MAB7957
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.5 mg/mL. A specific band was detected for Casein Kinase 2 alpha at approximately 50-52 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human Casein Kinase 2 alpha Monoclonal Antibody (Catalog # MAB7957) . This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line,MOLT‑4 human acute lymphoblastic leukemia cell line, NIH‑3T3 mouse embryonic fibroblast cell line, C6 rat glioma cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Casein Kinase 2 alpha Monoclonal Antibody (Catalog # MAB7957) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Casein Kinase 2 alpha at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Casein Kinase 2 alpha was detected in immersion fixed HEK293 human embryonic kidney cell line using Mouse Anti-Human Casein Kinase 2 alpha Monoclonal Antibody (Catalog # MAB7957) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, IHC, Simple Western, WB
RNF7 Antibody
NBP1-46159
Immunohistochemistry-Paraffin: RNF7 Antibody [NBP1-46159] - Staining of Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: RNF7 Antibody [NBP1-46159] - Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NGFI-B
alpha/Nur77/NR4A1 Ant
NB100-56745
Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - RNA-seq results were validated by Western blot analysis in WT and calpain-1 KO mice. Western blot images and quantifications showing the expression levels of NGFI-B alpha/Nur77/NR4A1 protein in three independent replicates, respectively. Dot plots were used for the quantification of the expression levels of protein compared to actin control in WT and calpain-1 KO mice. Unpaired t-test in Prism 7 was used to calculate p values, *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fgene.2020.00334/full), licensed under a CC-BY licence.
NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - U-251 MG cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with NGFI-B alpha/Nur77/NR4A1 Antibody (NB100-56745) at 1ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - Analysis of a FFPE tissue section of mouse brain using 1:200 dilution of NGFI-B alpha/Nur77/NR4A1 antibody (NB100-56745). The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(3 Reviews)
(25 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Histone H1
Antibody (HH1/957)
NBP2-45184
Immunocytochemistry/Immunofluorescence: Histone H1 Antibody (HH1/957) [NBP2-45184] - Human cell culture cells were fixed with paraformaldehyde, permeabilised and incubated 1 hour at RT with primary antibody. This image was submitted via customer review.
Immunohistochemistry-Paraffin: Histone H1 Antibody (HH1/957) [NBP2-45184] - Human Ovarian Carcinoma stained with Histone H1 Monoclonal Antibody (HH1/957)
Immunohistochemistry-Paraffin: Histone H1 Antibody (HH1/957) [NBP2-45184] - Human Tonsil stained with Histone H1 Monoclonal Antibody (HH1/957)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PATZ Antibody
NBP2-19708
Western Blot: PATZ Antibody [NBP2-19708] - Sample (30 ug of whole cell lysate) A: HCT116 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: PATZ Antibody [NBP2-19708] - Immunohistochemical analysis of paraffin-embedded Breast ca, using antibody at 1:250 dilution.
Immunocytochemistry/Immunofluorescence: PATZ Antibody [NBP2-19708] - Immunofluorescence analysis of paraformaldehyde-fixed HeLa, using antibody at 1:500 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TINAGL1 Antibody
(812417)
MAB7185
Simple Western lane view shows lysates of human placenta tissue, loaded at 0.5 mg/mL. A specific band was detected for TINAGL1 at approximately 59 kDa (as indicated) using 5 µg/mL of Mouse Anti-Human TINAGL1 Monoclonal Antibody (Catalog # MAB7185). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of human placenta tissue and human kidney tissue. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human TINAGL1 Monoclonal Antibody (Catalog # MAB7185) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for TINAGL1 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: Simple Western, WB
CRIF1 Antibody
NBP2-87211
CRIF1 Antibody
Species: Hu
Applications: WB

Publications for CRIF1 Antibody (NBP2-87211) (0)

There are no publications for CRIF1 Antibody (NBP2-87211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRIF1 Antibody (NBP2-87211) (0)

There are no reviews for CRIF1 Antibody (NBP2-87211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRIF1 Antibody (NBP2-87211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRIF1 Products

Bioinformatics Tool for CRIF1 Antibody (NBP2-87211)

Discover related pathways, diseases and genes to CRIF1 Antibody (NBP2-87211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRIF1 Antibody (NBP2-87211)

Discover more about diseases related to CRIF1 Antibody (NBP2-87211).
 

Pathways for CRIF1 Antibody (NBP2-87211)

View related products by pathway.

PTMs for CRIF1 Antibody (NBP2-87211)

Learn more about PTMs related to CRIF1 Antibody (NBP2-87211).

Blogs on CRIF1

There are no specific blogs for CRIF1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRIF1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GADD45GIP1