![Western Blot: CRIF1 Antibody [NBP2-87211] - WB Suggested Anti-GADD45GIP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellGADD45GIP1 is supported by BioGPS gene expression data to be expressed in HeLa](http://images.novusbio.com/fullsize/CRIF1-Antibody-Western-Blot-NBP2-87211-img0001.jpg "Western Blot: CRIF1 Antibody [NBP2-87211] - WB Suggested Anti-GADD45GIP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellGADD45GIP1 is supported by BioGPS gene expression data to be expressed in HeLa")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of CRIF1. Peptide sequence: SLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GADD45GIP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot NAC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NAC1_AF8375_Western_Blot_15897.jpg)
![Immunohistochemistry NAC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NAC1_AF8375_Immunohistochemistry_15904.jpg)
![Knockout Validated NAC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NAC1_AF8375_Knockout_Validated_22990.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CRIF1 Antibody (NBP2-87211)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GADD45GIP1 |
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Simple Western Casein Kinase 2 alpha Antibody (844720) [Unconjugated]](https://images.novusbio.com/images2/Casein_Kinase_2_alpha_MAB7957_Simple_Western_17150.jpg)
![Western Blot Casein Kinase 2 alpha Antibody (844720) [Unconjugated]](https://images.novusbio.com/images2/Casein_Kinase_2_alpha_MAB7957_Western_Blot_13018.jpg)
![Immunocytochemistry Casein Kinase 2 alpha Antibody (844720) [Unconjugated]](https://images.novusbio.com/images2/Casein_Kinase_2_alpha_MAB7957_Immunocytochemistry_13098.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
