CRHBP Antibody - BSA Free

Western Blot: CRHBP Antibody [NBP3-17697] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CRHBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CRHBP Antibody - BSA Free (NBP3-17697) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRHBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CRHBP Antibody - BSA Free

• corticotropin releasing hormone binding protein
• corticotropin-releasing factor-binding protein
• Corticotropin-releasing hormone-binding protein
• CRFBP
• CRFBPcorticotropin releasing hormone-binding protein
• CRF-BPCRF-binding protein
• CRHBP
• CRH-BP

Background

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRHBP