CREB Recombinant Protein Antigen

Images

 
There are currently no images for CREB Recombinant Protein Antigen (NBP1-90364PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CREB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CREB1.

Source: E. coli

Amino Acid Sequence: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CREB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90364.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CREB Recombinant Protein Antigen

  • active transcription factor CREB
  • cAMP responsive element binding protein 1
  • cAMP-response element-binding protein-1
  • cAMP-responsive element-binding protein 1
  • CREB
  • CREB1
  • CREB-1
  • cyclic AMP-responsive element-binding protein 1
  • MGC9284
  • transactivator protein

Background

CREB (cAMP responsive element binding protein 1) stimulates transcription. CREB is involved in learning and memory. This protein is known to have interactions with HIST1H3B, HIST1h3A, HIST1H3C, HIST1H3D and HIST1H3E. CREB has been studied in relation to several diseases and disorders including Rubinstein-Taybi syndrome, Alzheimer's disease, leukemia and brain disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
DBD00
Species: Hu
Applications: ELISA
212-GD
Species: Hu
Applications: Bind, BA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
1310-SE
Species: Hu
Applications: EnzAct
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-09392
Species: Hu, Mu
Applications: WB

Publications for CREB Recombinant Protein Antigen (NBP1-90364PEP) (0)

There are no publications for CREB Recombinant Protein Antigen (NBP1-90364PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREB Recombinant Protein Antigen (NBP1-90364PEP) (0)

There are no reviews for CREB Recombinant Protein Antigen (NBP1-90364PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CREB Recombinant Protein Antigen (NBP1-90364PEP). (Showing 1 - 1 of 1 FAQ).

  1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
    • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Additional CREB Products

Research Areas for CREB Recombinant Protein Antigen (NBP1-90364PEP)

Find related products by research area.

Blogs on CREB.

Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis
By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ...  Read full blog post.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CREB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB1