Recombinant Human CREB Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CREB Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 14-101 of Human CREB

Source: Wheat Germ

Amino Acid Sequence: DAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CREB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CREB Protein

  • active transcription factor CREB
  • cAMP responsive element binding protein 1
  • cAMP-response element-binding protein-1
  • cAMP-responsive element-binding protein 1
  • CREB
  • CREB1
  • CREB-1
  • cyclic AMP-responsive element-binding protein 1
  • MGC9284
  • transactivator protein

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF1310
Species: Hu
Applications: WB, IHC, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
H00001385-Q02
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CREB Partial Recombinant Protein (H00001385-Q02) (0)

There are no publications for CREB Partial Recombinant Protein (H00001385-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREB Partial Recombinant Protein (H00001385-Q02) (0)

There are no reviews for CREB Partial Recombinant Protein (H00001385-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREB Partial Recombinant Protein (H00001385-Q02). (Showing 1 - 1 of 1 FAQ).

  1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
    • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Additional CREB Products

Bioinformatics Tool for CREB Partial Recombinant Protein (H00001385-Q02)

Discover related pathways, diseases and genes to CREB Partial Recombinant Protein (H00001385-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB Partial Recombinant Protein (H00001385-Q02)

Discover more about diseases related to CREB Partial Recombinant Protein (H00001385-Q02).
 

Pathways for CREB Partial Recombinant Protein (H00001385-Q02)

View related products by pathway.

PTMs for CREB Partial Recombinant Protein (H00001385-Q02)

Learn more about PTMs related to CREB Partial Recombinant Protein (H00001385-Q02).
 

Research Areas for CREB Partial Recombinant Protein (H00001385-Q02)

Find related products by research area.

Blogs on CREB.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CREB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB1
Entrez