Creatine kinase MT 1B Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Creatine kinase MT 1B. Peptide sequence: TVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CKMT1B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Creatine kinase MT 1B Antibody - BSA Free
Background
Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for Creatine kinase MT 1B Antibody (NBP2-88790) (0)
There are no publications for Creatine kinase MT 1B Antibody (NBP2-88790).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Creatine kinase MT 1B Antibody (NBP2-88790) (0)
There are no reviews for Creatine kinase MT 1B Antibody (NBP2-88790).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Creatine kinase MT 1B Antibody (NBP2-88790) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Creatine kinase MT 1B Products
Research Areas for Creatine kinase MT 1B Antibody (NBP2-88790)
Find related products by research area.
|
Blogs on Creatine kinase MT 1B