CRB1 Antibody

Images

 
Immunohistochemistry-Paraffin: CRB1 Antibody [NBP2-55734] - Staining of human eye, retina shows moderate cytoplasmic positivity in photoreceptor cells and outer plexiform layer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL
Specificity
Specificity of human CRB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRB1 Recombinant Protein Antigen (NBP2-55734PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CRB1 Antibody

  • crumbs homolog 1 (Drosophila)
  • LCA8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, CyTOF-ready, IF
NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001406-M02
Species: Hu, Mu, Bv, Fi
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP2-13249
Species: Hu
Applications: IHC, IHC-P
NBP2-53232
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
H00145226-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-91809
Species: Hu
Applications: IHC, IHC-P
NB100-1354
Species: Hu
Applications: Flow, PEP-ELISA, IF
NBP1-81185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22896
Species: Hu
NBP1-30032
Species: Hu, Mu, Bv, Ca, Fe, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready, Dual ISH-IHC
NBP1-55416
Species: Hu
Applications: WB
NBP1-83195
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55734
Species: Hu
Applications: IHC, IHC-P

Publications for CRB1 Antibody (NBP2-55734) (0)

There are no publications for CRB1 Antibody (NBP2-55734).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRB1 Antibody (NBP2-55734) (0)

There are no reviews for CRB1 Antibody (NBP2-55734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRB1 Antibody (NBP2-55734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CRB1 Products

Array NBP2-55734

Bioinformatics Tool for CRB1 Antibody (NBP2-55734)

Discover related pathways, diseases and genes to CRB1 Antibody (NBP2-55734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRB1 Antibody (NBP2-55734)

Discover more about diseases related to CRB1 Antibody (NBP2-55734).
 

Pathways for CRB1 Antibody (NBP2-55734)

View related products by pathway.

PTMs for CRB1 Antibody (NBP2-55734)

Learn more about PTMs related to CRB1 Antibody (NBP2-55734).

Blogs on CRB1

There are no specific blogs for CRB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRB1