Recombinant Human Craniofacial Development Protein 1 Protein

Images

 
SDS-Page: Recombinant Human Craniofacial Development Protein 1 Protein [H00010428-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human Craniofacial Development Protein 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-299 of Human CFDP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CFDP1

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Craniofacial Development Protein 1 Protein

  • BCNTBUCENTAUR
  • Bucentaur
  • CP27phosphoprotein (Bucentaur)
  • craniofacial development protein 1
  • p97
  • SWC5
  • Yeti

Background

CFDP1 - craniofacial development protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46289
Species: Hu
Applications: WB, IHC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010428-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01) (0)

There are no publications for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01) (0)

There are no reviews for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Craniofacial Development Protein 1 Products

Bioinformatics Tool for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01)

Discover related pathways, diseases and genes to Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01)

Discover more about diseases related to Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01).
 

Pathways for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01)

View related products by pathway.

PTMs for Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01)

Learn more about PTMs related to Craniofacial Development Protein 1 Recombinant Protein (H00010428-P01).

Blogs on Craniofacial Development Protein 1

There are no specific blogs for Craniofacial Development Protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

eIF4G1 Antibody
NB100-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Craniofacial Development Protein 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CFDP1