CPT1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CPT1B Antibody [NBP1-84389] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: CPT1B Antibody [NBP1-84389] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CPT1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPT1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CPT1B Protein (NBP1-84389PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Alternate Names for CPT1B Antibody

  • carnitine O-palmitoyltransferase 1, muscle isoform
  • carnitine O-palmitoyltransferase I, mitochondrial muscle isoform
  • Carnitine O-palmitoyltransferase I, muscle isoform
  • carnitine palmitoyltransferase 1B (muscle)
  • Carnitine palmitoyltransferase 1B
  • Carnitine palmitoyltransferase I-like protein
  • CPT I
  • CPT1M
  • CPT1-MMCCPT1
  • CPTI
  • CPTI-M
  • EC 2.3.1
  • EC 2.3.1.21
  • FLJ55729
  • FLJ58750
  • KIAA1670
  • MCPT1
  • M-CPT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85471
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38108
Species: Hu
Applications: IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4099
Species: Hu
Applications: WB, IP
NB100-92012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB2091
Species: Hu
Applications: WB
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, ICC
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CPT1B Antibody (NBP1-84389) (0)

There are no publications for CPT1B Antibody (NBP1-84389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT1B Antibody (NBP1-84389) (0)

There are no reviews for CPT1B Antibody (NBP1-84389). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CPT1B Antibody (NBP1-84389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPT1B Antibody Products

Related Products by Gene

Bioinformatics Tool for CPT1B Antibody (NBP1-84389)

Discover related pathways, diseases and genes to CPT1B Antibody (NBP1-84389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT1B Antibody (NBP1-84389)

Discover more about diseases related to CPT1B Antibody (NBP1-84389).
 

Pathways for CPT1B Antibody (NBP1-84389)

View related products by pathway.

PTMs for CPT1B Antibody (NBP1-84389)

Learn more about PTMs related to CPT1B Antibody (NBP1-84389).
 

Research Areas for CPT1B Antibody (NBP1-84389)

Find related products by research area.

Blogs on CPT1B

There are no specific blogs for CPT1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CPT1B

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-84389 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought