RYR3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RYR3 Antibody [NBP2-76559] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RYR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RYR3 Antibody - BSA Free (NBP2-76559) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RYR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, containing 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RYR3 Antibody - BSA Free

• brain ryanodine receptor-calcium release channel
• brain-type ryanodine receptor
• HBRR
• ryanodine receptor 3
• RYR-3

Background

Ryanodine receptors, such as RYR3, are intracellular calcium ion release channels responsible for the release of Ca(2+) from intracellular stores following transduction of many different extracellular stimuli.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RYR3