CPN2 Antibody

Images

 
Western Blot: CPN2 Antibody [NBP2-82751] - WB Suggested Anti-CPN2 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysateCPN2 is supported by BioGPS gene expression data to be expressed in HepG2
Western Blot: CPN2 Antibody [NBP2-82751] - Host: Rabbit. Target Name: CHAD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

CPN2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CPN2. Peptide sequence: FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CPN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CPN2 Antibody

  • ACBP
  • arginine carboxypeptidase (carboxypeptidase N)
  • carboxypeptidase N 83 kDa chain
  • carboxypeptidase N large subunit
  • carboxypeptidase N regulatory subunit
  • carboxypeptidase N subunit 2
  • carboxypeptidase N, polypeptide 2
  • polypeptide 2, 83kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87695
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57960
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-52823
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP2-16708
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
H00008904-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP1-90660
Species: Hu
Applications: IHC, IHC-P
NBP2-94045
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for CPN2 Antibody (NBP2-82751) (0)

There are no publications for CPN2 Antibody (NBP2-82751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPN2 Antibody (NBP2-82751) (0)

There are no reviews for CPN2 Antibody (NBP2-82751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPN2 Antibody (NBP2-82751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPN2