CPA3 Antibody

Images

 
Western Blot: CPA3 Antibody [NBP1-86130] - Analysis in human plasma.
Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in mast cells.
Western Blot: CPA3 Antibody [NBP1-86130] - Analysis in control (vector only transfected HEK293T lysate) and CPA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Analysis in human small intestine and skeletal muscle tissues. Corresponding CPA3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in mast cells.
Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human skin shows moderate to strong cytoplasmic positivity in mast cells.
Independent Antibodies: Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86130] - Staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody NBP1-86130 (A) shows ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNER
Specificity
Specificity of human CPA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CPA3 Protein (NBP1-86130PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPA3 Antibody

  • carboxypeptidase A3 (mast cell)
  • Carboxypeptidase A3
  • EC 3.4.17
  • EC 3.4.17.1
  • mast cell carboxypeptidase A
  • MC-CPA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-15698
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-26444
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for CPA3 Antibody (NBP1-86130) (0)

There are no publications for CPA3 Antibody (NBP1-86130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPA3 Antibody (NBP1-86130) (0)

There are no reviews for CPA3 Antibody (NBP1-86130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPA3 Antibody (NBP1-86130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CPA3 Products

Bioinformatics Tool for CPA3 Antibody (NBP1-86130)

Discover related pathways, diseases and genes to CPA3 Antibody (NBP1-86130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPA3 Antibody (NBP1-86130)

Discover more about diseases related to CPA3 Antibody (NBP1-86130).
 

Pathways for CPA3 Antibody (NBP1-86130)

View related products by pathway.

PTMs for CPA3 Antibody (NBP1-86130)

Learn more about PTMs related to CPA3 Antibody (NBP1-86130).

Blogs on CPA3

There are no specific blogs for CPA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPA3