CPA3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86117] - Staining of human small intestine shows strong cytoplasmic positivity in mast cells.

Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86117] - Staining of human cervix, uterine shows strong cytoplasmic positivity in mast cells.

Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86117] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CPA3 Antibody [NBP1-86117] - Staining of human skin shows strong cytoplasmic positivity in mast cells.

Staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody NBP1-86117 (A) shows similar protein distribution across tissues to independent antibody NBP1-86130 (B).

Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA008689 antibody. Corresponding CPA3 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPA3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPA3 Antibody - BSA Free (NBP1-86117) is a polyclonal antibody validated for use in IHC. Anti-CPA3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CPA3 Protein (NBP1-86117PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 22534535)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPA3 Antibody - BSA Free

• carboxypeptidase A3 (mast cell)
• Carboxypeptidase A3
• EC 3.4.17
• EC 3.4.17.1
• mast cell carboxypeptidase A
• MC-CPA

Background

Three different forms of human pancreatic procarboxypeptidase A have been isolated. This gene encodes a form which is obtained as a binary complex of a procarboxypeptidase A with proproteinase E and functions as a secretory granule metalloexopeptidase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPA3 Antibody (NBP1-86117)(1)

Publication using NBP1-86117

• Takabayashi T, Kato A, Peters AT et al. Glandular mast cells with distinct phenotype are highly elevated in chronic rhinosinusitis with nasal polyps. J Allergy Clin Immunol 2012-08-01 [PMID: 22534535]

Bioinformatics

• Gene Symbol: CPA3