COX8C Antibody

Images

 
Western Blot: COX8C Antibody [NBP1-84400] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: COX8C Antibody [NBP1-84400] - Staining testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COX8C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX8C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COX8C Protein (NBP1-84400PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX8C Antibody

  • COX VIII-3
  • COX8-3
  • Cytochrome c oxidase polypeptide 8 isoform 3
  • cytochrome c oxidase polypeptide 8
  • Cytochrome c oxidase polypeptide VIII isoform 3
  • cytochrome c oxidase polypeptide VIII
  • Cytochrome c oxidase subunit 8-3
  • cytochrome c oxidase subunit 8C
  • cytochrome c oxidase subunit 8C, mitochondrial
  • cytochrome c oxidase subunit VIII
  • MGC119774
  • MGC119775

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-13592
Species: Hu
Applications: WB
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB600-669
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84400
Species: Hu
Applications: WB, IHC, IHC-P

Publications for COX8C Antibody (NBP1-84400) (0)

There are no publications for COX8C Antibody (NBP1-84400).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX8C Antibody (NBP1-84400) (0)

There are no reviews for COX8C Antibody (NBP1-84400). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX8C Antibody (NBP1-84400) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX8C Products

Bioinformatics Tool for COX8C Antibody (NBP1-84400)

Discover related pathways, diseases and genes to COX8C Antibody (NBP1-84400). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX8C Antibody (NBP1-84400)

Discover more about diseases related to COX8C Antibody (NBP1-84400).
 

Pathways for COX8C Antibody (NBP1-84400)

View related products by pathway.

Blogs on COX8C

There are no specific blogs for COX8C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX8C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX8C
Entrez
Uniprot