COX5b Antibody

Western Blot: COX5b Antibody [H00001329-B01P] - Analysis of COX5B expression in human pancreas.

Immunocytochemistry/Immunofluorescence: COX5b Antibody [H00001329-B01P] - Analysis of purified antibody to COX5B on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: COX5b Antibody [H00001329-B01P] - Analysis of COX5B expression in HepG2.

Western Blot: COX5b Antibody [H00001329-B01P] - Analysis of COX5B expression in transfected 293T cell line by COX5B polyclonal antibody. Lane1:COX5B transfected lysate(14.19 KDa). Lane2:Non-transfected lysate.

Product Discontinued

COX5b Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: COX5B (NP_001853.2, 1 a.a. - 129 a.a.) full-length human protein. MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
• Specificity: COX5B - cytochrome c oxidase subunit Vb,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: COX5B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX5b Antibody

• COXVB
• Cytochrome c oxidase polypeptide Vb
• cytochrome c oxidase polypeptide VB, mitochondrial
• cytochrome c oxidase subunit 5B, mitochondrial
• cytochrome c oxidase subunit Vb

Background

Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX5B
• Entrez:
  • 1329(Human)
• Uniprot:
  • NP_001853.2(Human)