We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human COX11 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human COX11 Protein [H00001353-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related COX11 Peptides and Proteins

Order Details


    • Catalog Number
      H00001353-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human COX11 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-276 of Human COX11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
COX11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
57.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX11 GST (N-Term) Protein

  • COX11 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX11 cytochrome c oxidase assembly homolog (yeast)
  • COX11 homolog, cytochrome c oxidase assembly protein
  • COX11P
  • cytochrome c oxidase assembly protein COX11, mitochondrial
  • cytochrome c oxidase subunit 11

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. A related pseudogene has been found on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-87073
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-99469
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-77274
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-86322
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-45165
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-87850
Species: Hu
Applications:  IHC-P
H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP3-35454
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-74048
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-35253
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89663
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85500
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59376
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-02962
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB

Publications for COX11 Recombinant Protein (H00001353-P01) (0)

There are no publications for COX11 Recombinant Protein (H00001353-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX11 Recombinant Protein (H00001353-P01) (0)

There are no reviews for COX11 Recombinant Protein (H00001353-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX11 Recombinant Protein (H00001353-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX11 Products

Research Areas for COX11 Recombinant Protein (H00001353-P01)

Find related products by research area.

Blogs on COX11

There are no specific blogs for COX11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COX11