Recombinant Human Coronin 3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Coronin 3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 375-473 of Human CORO1C partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA

Protein/Peptide Type
Partial Recombinant Protein
Gene
CORO1C

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Coronin 3 Protein

  • coronin 1C
  • coronin, actin binding protein, 1C
  • coronin, actin-binding protein, 1C
  • coronin-1C
  • Coronin-3
  • CRNN4
  • HCRNN4

Background

CORO1C - coronin, actin binding protein, 1C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15968
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-61040
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF1444
Species: Mu
Applications: WB, IHC
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-43369
Species: Hu, Bv
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP

Publications for Coronin 3 Partial Recombinant Protein (H00023603-Q01) (0)

There are no publications for Coronin 3 Partial Recombinant Protein (H00023603-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coronin 3 Partial Recombinant Protein (H00023603-Q01) (0)

There are no reviews for Coronin 3 Partial Recombinant Protein (H00023603-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coronin 3 Partial Recombinant Protein (H00023603-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Coronin 3 Products

Bioinformatics Tool for Coronin 3 Partial Recombinant Protein (H00023603-Q01)

Discover related pathways, diseases and genes to Coronin 3 Partial Recombinant Protein (H00023603-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coronin 3 Partial Recombinant Protein (H00023603-Q01)

Discover more about diseases related to Coronin 3 Partial Recombinant Protein (H00023603-Q01).
 

Pathways for Coronin 3 Partial Recombinant Protein (H00023603-Q01)

View related products by pathway.

PTMs for Coronin 3 Partial Recombinant Protein (H00023603-Q01)

Learn more about PTMs related to Coronin 3 Partial Recombinant Protein (H00023603-Q01).

Blogs on Coronin 3

There are no specific blogs for Coronin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Coronin 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CORO1C