Coronin 3 Antibody (1F7) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Coronin 3 Antibody (1F7) - Azide and BSA Free (H00023603-M02) is a monoclonal antibody validated for use in IHC, WB and ELISA. Anti-Coronin 3 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CORO1C (NP_055140, 375 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA |
| Specificity |
CORO1C - coronin, actin binding protein, 1C (1F7) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CORO1C |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Coronin 3 Antibody (1F7) - Azide and BSA Free
Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Publications for Coronin 3 Antibody (H00023603-M02)(4)
Showing Publications 1 -
4 of 4.
| Publications using H00023603-M02 |
Applications |
Species |
| Jun L, Lusong T, Zongpan J et al. Cytoplasmic RAD23B interacts with CORO1C to synergistically promote colorectal cancer progression and metastasis. Cancer Lett. 2021-05-29 [PMID: 34062216] |
|
|
| Lim JP, Shyamasundar S, Gunaratne J et al. YBX1 gene silencing inhibits migratory and invasive potential via CORO1C in breast cancer in vitro. BMC Cancer 2017-03-16 [PMID: 28302118] |
|
|
| MA L‚cuyer, O Saint-Laur, L BourbonniŠ, S Larouche, C Larochelle, L Michel, M Charabati, M Abadier, S Zandee, N Haghayegh, E Gowing, C Pittet, R Lyck, B Engelhardt, A Prat Dual role of ALCAM in neuroinflammation and blood-brain barrier homeostasis Proc. Natl. Acad. Sci. U.S.A, 2017-01-09;114(4):E524-E533. 2017-01-09 [PMID: 28069965] |
|
|
| Kimura T, Yamaoka M, Taniguchi S et al. Activated Cdc42-Bound IQGAP1 Determines the Cellular Endocytic Site. Mol Cell Biol. 2013-10-07 [PMID: 24100016] |
|
|
Reviews for Coronin 3 Antibody (H00023603-M02) (0)
There are no reviews for Coronin 3 Antibody (H00023603-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Coronin 3 Antibody (H00023603-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Coronin 3 Products
Blogs on Coronin 3