COQ6 Antibody

Images

 
Immunohistochemistry-Paraffin: COQ6 Antibody [NBP2-13860] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COQ6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKD NLDDMGYIVENDVIMHALTKQLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COQ6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COQ6 Protein (NBP2-13860PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COQ6 Antibody

  • CGI-10
  • coenzyme Q6 homolog (yeast)
  • coenzyme Q6 homolog, monooxygenase (S. cerevisiae)
  • coenzyme Q6 homolog, monooxygenase (yeast)
  • EC 1.14.13
  • EC 1.14.13.-
  • ubiquinone biosynthesis monooxygenase COQ6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91806
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88724
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP1-88450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
H00000141-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3159
Species: Mu
Applications: WB, IHC
NBP2-46222
Species: Hu
Applications: WB, IHC, IF
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF6637
Species: Mu
Applications: WB, IHC
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COQ6 Antibody (NBP2-13860) (0)

There are no publications for COQ6 Antibody (NBP2-13860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ6 Antibody (NBP2-13860) (0)

There are no reviews for COQ6 Antibody (NBP2-13860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COQ6 Antibody (NBP2-13860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COQ6 Products

Bioinformatics Tool for COQ6 Antibody (NBP2-13860)

Discover related pathways, diseases and genes to COQ6 Antibody (NBP2-13860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ6 Antibody (NBP2-13860)

Discover more about diseases related to COQ6 Antibody (NBP2-13860).
 

Pathways for COQ6 Antibody (NBP2-13860)

View related products by pathway.

PTMs for COQ6 Antibody (NBP2-13860)

Learn more about PTMs related to COQ6 Antibody (NBP2-13860).

Blogs on COQ6

There are no specific blogs for COQ6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ6