COPS6 Recombinant Protein Antigen

Images

 
There are currently no images for COPS6 Protein (NBP1-91805PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COPS6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COPS6.

Source: E. coli

Amino Acid Sequence: EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COPS6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91805.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COPS6 Recombinant Protein Antigen

  • BMP2B
  • BMP2B1
  • BMP4
  • COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
  • COP9 signalosome complex subunit 6
  • CSN6COP9 subunit 6 (MOV34 homolog, 34 kD)
  • H_NH0506M12.12
  • HVIP
  • JAB1-containing signalosome subunit 6
  • MOFC11
  • MOV34 homolog
  • MOV34 homolog, 34 kD
  • MOV34-34KD
  • SGN6
  • Signalosome subunit 6
  • Vpr-interacting protein

Background

COPS6 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-35268
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1988
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IP, Neut, WB
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80956
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-15962
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-92907
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55090
Species: Hu
Applications: IHC,  IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-27203
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-78040
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-91805PEP
Species: Hu
Applications: AC

Publications for COPS6 Protein (NBP1-91805PEP) (0)

There are no publications for COPS6 Protein (NBP1-91805PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPS6 Protein (NBP1-91805PEP) (0)

There are no reviews for COPS6 Protein (NBP1-91805PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COPS6 Protein (NBP1-91805PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COPS6 Products

Research Areas for COPS6 Protein (NBP1-91805PEP)

Find related products by research area.

Blogs on COPS6

There are no specific blogs for COPS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COPS6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS6