COP Antibody - Azide and BSA Free

Western Blot: COP Antibody [H00114769-B01P] - Analysis of CARD16 expression in transfected 293T cell line by CARD16 polyclonal antibody. Lane 1: COP1 transfected lysate(10.67 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: COP Antibody [H00114769-B01P] - Analysis of purified antibody to COP1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COP Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse COP Antibody - Azide and BSA Free (H00114769-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: COP1 (NP_443121.1, 1 a.a. - 97 a.a.) full-length human protein. MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
• Specificity: COP1 - caspase-1 dominant-negative inhibitor pseudo-ICE,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CARD16
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COP Antibody - Azide and BSA Free

• CARD only domain-containing protein 1
• CARD only protein
• caspase recruitment domain family, member 16
• Caspase-1 inhibitor COP
• COP1caspase-1 dominant-negative inhibitor pseudo-ICE
• COPcaspase recruitment domain-containing protein 16
• EC 3.4.22.36
• Pseudo interleukin-1 beta converting enzyme
• pseudo interleukin-1beta converting enzyme
• PSEUDO-ICE

Background

Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of theproteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release ofIL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokineresponse. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, andstaurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspasesCASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CARD16
• Entrez:
  • 114769(Human)
• Uniprot:
  • NP_443121.1(Human)