Connexin 43/GJA1 Recombinant Protein Antigen

Images

 
There are currently no images for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Connexin 43/GJA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Connexin 43/GJA1.

Source: E. coli

Amino Acid Sequence: GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GJA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68678.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Connexin 43/GJA1 Recombinant Protein Antigen

  • Connexin 43
  • connexin-43
  • CX43
  • CX43gap junction protein, alpha-like
  • DFNB38
  • Gap junction 43 kDa heart protein
  • gap junction alpha-1 protein
  • gap junction protein, alpha 1, 43kDa (connexin 43)
  • gap junction protein, alpha 1, 43kDa
  • GJA1
  • GJAL
  • HSS
  • ODD
  • ODDD
  • ODOD
  • SDTY3

Background

Connexin 43/GJA1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. GJA1 is the major cardiac gap junction protein, which is thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. GJA1 is targeted by several protein kinases that regulate myocardial cell cell coupling. A related intronless GJA1 pseudogene, GJA1P, has been mapped to chromosome 5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-59254
Species: Hu, Mu
Applications: IHC, IHC-Fr,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
233-FB
Species: Hu
Applications: BA
NBP2-58660
Species: Hu
Applications: IHC,  IHC-P
NBP2-68678PEP
Species: Hu
Applications: AC

Publications for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP) (0)

There are no publications for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP) (0)

There are no reviews for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 43/GJA1 Products

Research Areas for Connexin 43/GJA1 Recombinant Protein Antigen (NBP2-68678PEP)

Find related products by research area.

Blogs on Connexin 43/GJA1.

Connexin: Bridging the Gap of Intercellular Communication
Connexin 43/GJA1 is a member of the connexin gene family and the most abundant protein component found within gap junctions. Gap junctions are the cell-to-cell contacts that provide direct intercellular communication between cells by regulating back a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Connexin 43/GJA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GJA1