Connexin 36/GJD2 Antibody


Western Blot: Connexin 36/GJD2 Antibody [NBP1-70507] - Human Muscle lysate, concentration 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Connexin 36/GJD2 Antibody Summary

Synthetic peptides corresponding to CX36 The peptide sequence was selected from the middle region of CX36. Peptide sequence NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CX36 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Connexin 36/GJD2 Antibody

  • Connexin 36
  • Connexin-36
  • CX36
  • CX36connexin 36
  • Gap junction alpha-9 protein
  • gap junction delta-2 protein
  • gap junction protein, alpha 9, 36kDa
  • gap junction protein, delta 2, 36kDa
  • GJA9connexin-36
  • GJD2
  • MGC138315
  • MGC138319


GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Connexin 36/GJD2 Antibody (NBP1-70507) (0)

There are no publications for Connexin 36/GJD2 Antibody (NBP1-70507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 36/GJD2 Antibody (NBP1-70507) (0)

There are no reviews for Connexin 36/GJD2 Antibody (NBP1-70507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 36/GJD2 Antibody (NBP1-70507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Connexin 36/GJD2 Products

Bioinformatics Tool for Connexin 36/GJD2 Antibody (NBP1-70507)

Discover related pathways, diseases and genes to Connexin 36/GJD2 Antibody (NBP1-70507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 36/GJD2 Antibody (NBP1-70507)

Discover more about diseases related to Connexin 36/GJD2 Antibody (NBP1-70507).

Pathways for Connexin 36/GJD2 Antibody (NBP1-70507)

View related products by pathway.

PTMs for Connexin 36/GJD2 Antibody (NBP1-70507)

Learn more about PTMs related to Connexin 36/GJD2 Antibody (NBP1-70507).

Blogs on Connexin 36/GJD2

There are no specific blogs for Connexin 36/GJD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Connexin 36/GJD2 Antibody and receive a gift card or discount.


Gene Symbol GJD2