Connexin 36/GJD2 Antibody

Western Blot: Connexin 36/GJD2 Antibody [NBP1-70507] - Human Muscle lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Connexin 36/GJD2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to CX36 The peptide sequence was selected from the middle region of CX36. Peptide sequence NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJD2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against CX36 and was validated on Western blot.
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Connexin 36/GJD2 Antibody

• Connexin 36
• Connexin-36
• CX36
• CX36connexin 36
• Gap junction alpha-9 protein
• gap junction delta-2 protein
• gap junction protein, alpha 9, 36kDa
• gap junction protein, delta 2, 36kDa
• GJA9connexin-36
• GJD2
• MGC138315
• MGC138319

Background

GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJD2