Connexin 36/GJD2 Antibody Summary
Immunogen |
Synthetic peptides corresponding to CX36 The peptide sequence was selected from the middle region of CX36. Peptide sequence NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GJD2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against CX36 and was validated on Western blot. |
Theoretical MW |
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Connexin 36/GJD2 Antibody
Background
GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM].
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
Publications for Connexin 36/GJD2 Antibody (NBP1-70507) (0)
There are no publications for Connexin 36/GJD2 Antibody (NBP1-70507).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Connexin 36/GJD2 Antibody (NBP1-70507) (0)
There are no reviews for Connexin 36/GJD2 Antibody (NBP1-70507).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Connexin 36/GJD2 Antibody (NBP1-70507) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Connexin 36/GJD2 Products
Bioinformatics Tool for Connexin 36/GJD2 Antibody (NBP1-70507)
Discover related pathways, diseases and genes to Connexin 36/GJD2 Antibody (NBP1-70507). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Connexin 36/GJD2 Antibody (NBP1-70507)
Discover more about diseases related to Connexin 36/GJD2 Antibody (NBP1-70507).
| | Pathways for Connexin 36/GJD2 Antibody (NBP1-70507)
View related products by pathway.
|
PTMs for Connexin 36/GJD2 Antibody (NBP1-70507)
Learn more about PTMs related to Connexin 36/GJD2 Antibody (NBP1-70507).
|
Blogs on Connexin 36/GJD2