Common beta Chain Recombinant Protein Antigen

Product Discontinued

Common beta Chain Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Common beta Chain.
  
  

  Source: E. coli

  Amino Acid Sequence: QQVGDYCFLPGLGPGPLSLRSKPSSPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CSF2RB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76540.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Common beta Chain Recombinant Protein Antigen

• beta, low-affinity
• CD131 antigen
• CD131
• CDw131
• colony stimulating factor 2 receptor, beta, low-affinity(granulocyte-macrophage)
• Common beta Chain
• CSF2RB
• cytokine receptor common subunit beta
• GM-CSF R beta
• GM-CSF/IL-3/IL-5 receptor common beta subunit
• GM-CSF/IL-3/IL-5 receptor common beta-chain
• IL-3 R beta
• IL3RB
• IL-5 R beta
• interleukin 3 receptor/granulocyte-macrophage colony stimulating factor 3receptor, beta (high affinity)

Background

Interleukin-3 receptor (IL-3R) is a heterodimer cytokine composed of alpha chain and beta chain. IL-3R beta subunit (CD131, beta C) is a common shared beta chain of the receptor for granulocyte- macrophage colony-stimulating factor (GM-CSF) and IL-5 (1). While the beta chain can not bind to the ligand alone, but it is essential for high affinity ligand binding (2). The cytoplasmic portion of the beta chain contains the major domains necessary for ligand-induced proliferation (3). IL-3R beta is expressed in neutrophil, eosinophil, monocyte, and hematpoietic stem cells. A point mutation leading to defective IL-3R beta expression has been associated to Human pulmonary alveolar proteinosis (PAP), a rare cause of respiratory failure (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CSF2RB