Common beta Chain Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Common beta Chain Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-76540PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Common beta Chain Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Common beta Chain.

Source: E. coli

Amino Acid Sequence: QQVGDYCFLPGLGPGPLSLRSKPSSPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CSF2RB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76540.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Common beta Chain Recombinant Protein Antigen

  • beta, low-affinity
  • CD131 antigen
  • CD131
  • CDw131
  • colony stimulating factor 2 receptor, beta, low-affinity(granulocyte-macrophage)
  • Common beta Chain
  • CSF2RB
  • cytokine receptor common subunit beta
  • GM-CSF R beta
  • GM-CSF/IL-3/IL-5 receptor common beta subunit
  • GM-CSF/IL-3/IL-5 receptor common beta-chain
  • IL-3 R beta
  • IL3RB
  • IL-5 R beta
  • interleukin 3 receptor/granulocyte-macrophage colony stimulating factor 3receptor, beta (high affinity)

Background

Interleukin-3 receptor (IL-3R) is a heterodimer cytokine composed of alpha chain and beta chain. IL-3R beta subunit (CD131, beta C) is a common shared beta chain of the receptor for granulocyte- macrophage colony-stimulating factor (GM-CSF) and IL-5 (1). While the beta chain can not bind to the ligand alone, but it is essential for high affinity ligand binding (2). The cytoplasmic portion of the beta chain contains the major domains necessary for ligand-induced proliferation (3). IL-3R beta is expressed in neutrophil, eosinophil, monocyte, and hematpoietic stem cells. A point mutation leading to defective IL-3R beta expression has been associated to Human pulmonary alveolar proteinosis (PAP), a rare cause of respiratory failure (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

203-IL
Species: Hu
Applications: BA
M5000
Species: Mu
Applications: ELISA
7954-GM/CF
Species: Hu
Applications: BA
MEP00B
Species: Mu
Applications: ELISA
7954-GM/CF
Species: Hu
Applications: BA
AF906
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP3-07388
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P
DTM100
Species: Hu
Applications: ELISA
MAB6130
Species: Mu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-67429
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Neut, WB
6507-IL/CF
Species: Hu
Applications: BA
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
MAB307
Species: Hu
Applications: Flow, IP, WB
230-4RB
Species: Hu
Applications: BA
DGP00
Species: Hu
Applications: ELISA
AF3388
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
202-IL
Species: Hu
Applications: BA

Publications for Common beta Chain Recombinant Protein Antigen (NBP2-76540PEP) (0)

There are no publications for Common beta Chain Recombinant Protein Antigen (NBP2-76540PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Common beta Chain Recombinant Protein Antigen (NBP2-76540PEP) (0)

There are no reviews for Common beta Chain Recombinant Protein Antigen (NBP2-76540PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Common beta Chain Recombinant Protein Antigen (NBP2-76540PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Common beta Chain Products

Research Areas for Common beta Chain Recombinant Protein Antigen (NBP2-76540PEP)

Find related products by research area.

Blogs on Common beta Chain

There are no specific blogs for Common beta Chain, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Common beta Chain Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF2RB