Common beta Chain Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QQVGDYCFLPGLGPGPLSLRSKPSSPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CSF2RB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, containing 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Common beta Chain Antibody
Background
Interleukin-3 receptor (IL-3R) is a heterodimer cytokine composed of alpha chain and beta chain. IL-3R beta subunit (CD131, beta C) is a common shared beta chain of the receptor for granulocyte- macrophage colony-stimulating factor (GM-CSF) and IL-5 (1). While the beta chain can not bind to the ligand alone, but it is essential for high affinity ligand binding (2). The cytoplasmic portion of the beta chain contains the major domains necessary for ligand-induced proliferation (3). IL-3R beta is expressed in neutrophil, eosinophil, monocyte, and hematpoietic stem cells. A point mutation leading to defective IL-3R beta expression has been associated to Human pulmonary alveolar proteinosis (PAP), a rare cause of respiratory failure (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: B/N, Flow, Func, ICC/IF, IHC, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Publications for Common beta Chain Antibody (NBP2-76540) (0)
There are no publications for Common beta Chain Antibody (NBP2-76540).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Common beta Chain Antibody (NBP2-76540) (0)
There are no reviews for Common beta Chain Antibody (NBP2-76540).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Common beta Chain Antibody (NBP2-76540) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Common beta Chain Products
Research Areas for Common beta Chain Antibody (NBP2-76540)
Find related products by research area.
|
Blogs on Common beta Chain