Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free

Name: Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free
Brand: Novus Biologicals
SKU: H00091522-M03
Price: 499 USD
Availability: InStock

Submit a Review

Images

(

Enlarge)

ELISA: Collagen XXIII alpha 1 Antibody (2E10) [H00091522-M03] - Detection limit for recombinant GST tagged COL23A1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA
Clone	2E10
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated
Format	Azide and BSA Free

Order Details

Novus Biologicals offers 100% Guarantee

Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free Summary

Immunogen	COL23A1 (NP_775736, 338 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE
Specificity	COL23A1 (2E10)
Isotype	IgG2b Kappa
Clonality	Monoclonal
Host	Mouse
Gene	COL23A1
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Western Blot 1:500
Application Notes	Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free

COL23A1
collagen alpha-1(XXIII) chain
Collagen XXIII alpha 1
collagen, type XXIII, alpha 1
DKFZp434K0621
procollagen, type XXIII, alpha 1

Background

COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTGF/CCN2 Antibody
[Unconjugated] - C-te ...

AF660

Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus

(7 Publications)

Species: Hu

Applications: IHC

Fibronectin
Antibody - BSA Free

NBP1-91258

(11 Reviews)

(56 Publications)

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Kallikrein 3/PSA
[HRP]

DKK300

(18 Publications)

Species: Hu

Applications: ELISA

Actin Alpha 1
Cardiac Muscle Antibo ...

NBP1-97725

Immunocytochemistry/ Immunofluorescence Actin Alpha 1 Cardiac Muscle Antibody (22D3) - BSA Free

(1 Review)

(2 Publications)

Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Neuronal Pentraxin
1

7707-NP

(1 Publication)

Species: Hu

Applications: BA

EDNRA/Endothelin R
Type A Antibody - Azi ...

NB600-836

Western Blot EDNRA/Endothelin R Type A Antibody - Azide and BSA Free

(1 Review)

(4 Publications)

Species: Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

Protein S/PROS1
Antibody [Unconjugate

AF4036

Simple Western Protein S/PROS1 Antibody [Unconjugated]

(7 Publications)

Species: Hu

Applications: Simple Western, WB

ARHGAP10 Antibody
- BSA Free

NBP3-47971

Western Blot ARHGAP10 Antibody - BSA Free

Species: Hu, Mu

Applications: ELISA, IHC, WB

Endostatin [HRP]

DNST0

(22 Publications)

Species: Hu

Applications: ELISA

CD90/Thy1 Antibody

AF2067

(1 Review)

(13 Publications)

Species: Ca, Hu, Po

Applications: CyTOF-ready, Flow, ICC, IHC, WB

Matrilin-2
Antibody [Unconjugate

AF3044

Immunohistochemistry Matrilin-2 Antibody [Unconjugated]

Species: Hu

Applications: ICC, WB

SOX3 Antibody
[Unconjugated]

AF2569

Western Blot SOX3 Antibody [Unconjugated]

(13 Publications)

Species: Hu

Applications: ICC, WB

GLYAT Antibody -
BSA Free

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

FGF acidic/FGF1
Antibody [Unconjugate

AF232

Simple Western FGF acidic/FGF1 Antibody [Unconjugated]

Western Blot FGF acidic/FGF1 Antibody [Unconjugated]

(15 Publications)

Species: Hu

Applications: IHC, Neut, Simple Western, WB

Collagen III alpha
1/COL3A1 Antibody - B ...

NB600-594

Western Blot Collagen III alpha 1/COL3A1 Antibody - BSA Free

(7 Reviews)

(51 Publications)

Species: Bv, Fe, Hu, Mu, Rt, Sh

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

KIF18A Antibody -
BSA Free

NBP1-85126

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

ER alpha/NR3A1
Antibody (33)

NB300-560

Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)

Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)

(1 Review)

(11 Publications)

Species: Av, Bv, Ma, Hu, Mu, Pm, Rt

Applications: IF, IHC, IHC-Fr, IHC-P, WB

PGRMC2 Antibody
(3C11) - Azide and BS ...

H00010424-M04

Immunohistochemistry-Paraffin PGRMC2 Antibody (3C11) - Azide and BSA Free

(2 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB

Publications for Collagen XXIII alpha 1 Antibody (H00091522-M03) (0)

There are no publications for Collagen XXIII alpha 1 Antibody (H00091522-M03).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XXIII alpha 1 Antibody (H00091522-M03) (0)

There are no reviews for Collagen XXIII alpha 1 Antibody (H00091522-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XXIII alpha 1 Antibody (H00091522-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional Collagen XXIII alpha 1 Products

Blogs on Collagen XXIII alpha 1

There are no specific blogs for Collagen XXIII alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol	COL23A1
Entrez	91522(Human)
Uniprot	NP_775736()

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free

Species Glossary

Images

Product Details

Order Details

Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for Collagen XXIII alpha 1 Antibody (2E10) - Azide and BSA Free

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Collagen XXIII alpha 1 Antibody (H00091522-M03) (0)

Reviews for Collagen XXIII alpha 1 Antibody (H00091522-M03) (0)

Product General Protocols

Video Protocols

FAQs for Collagen XXIII alpha 1 Antibody (H00091522-M03) (0)

Secondary Antibodies

Isotype Controls

Additional Collagen XXIII alpha 1 Products

Blogs on Collagen XXIII alpha 1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics