Collagen XXI Antibody (1G6) Summary
Immunogen |
COL21A1 (NP_110447, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL |
Specificity |
This product is specific for Human COL21A1 monoclonal antibody (M01), clone 1G6 [Gene ID: 81578]. |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
COL21A1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Mouse monoclonal antibody raised against a partial recombinant COL21A1. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Collagen XXI Antibody (1G6)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, KO, WB
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
Publications for Collagen XXI Antibody (H00081578-M01) (0)
There are no publications for Collagen XXI Antibody (H00081578-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Collagen XXI Antibody (H00081578-M01) (0)
There are no reviews for Collagen XXI Antibody (H00081578-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Collagen XXI Antibody (H00081578-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Collagen XXI Products
Bioinformatics Tool for Collagen XXI Antibody (H00081578-M01)
Discover related pathways, diseases and genes to Collagen XXI Antibody (H00081578-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Collagen XXI Antibody (H00081578-M01)
Discover more about diseases related to Collagen XXI Antibody (H00081578-M01).
| | Pathways for Collagen XXI Antibody (H00081578-M01)
View related products by pathway.
|
PTMs for Collagen XXI Antibody (H00081578-M01)
Learn more about PTMs related to Collagen XXI Antibody (H00081578-M01).
| | Research Areas for Collagen XXI Antibody (H00081578-M01)
Find related products by research area.
|
Blogs on Collagen XXI