Recombinant Human COL8A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COL8A2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-427 of Human COL8A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGDKGESGPPGAFDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
COL8A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COL8A2 Protein

  • alpha-2 polypeptide
  • collagen, type VIII, alpha 2
  • dJ665N4.1 (collagen type VIII alpha 2)
  • FECD
  • FLJ00201
  • MGC116970
  • PPCD
  • PPCD2MGC116972

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-88514
Species: Hu
Applications: IHC, IHC-P
H00030813-R02
Species: Hu
NBP2-13856
Species: Hu
Applications: IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
MAB4608
Species: Hu, Mu, Rt
Applications: WB
NBP2-57206
Species: Hu
Applications: ICC/IF
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF650
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-05118
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85836
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00001296-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for COL8A2 Recombinant Protein (H00001296-P01) (0)

There are no publications for COL8A2 Recombinant Protein (H00001296-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL8A2 Recombinant Protein (H00001296-P01) (0)

There are no reviews for COL8A2 Recombinant Protein (H00001296-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COL8A2 Recombinant Protein (H00001296-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COL8A2 Products

Bioinformatics Tool for COL8A2 Recombinant Protein (H00001296-P01)

Discover related pathways, diseases and genes to COL8A2 Recombinant Protein (H00001296-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL8A2 Recombinant Protein (H00001296-P01)

Discover more about diseases related to COL8A2 Recombinant Protein (H00001296-P01).
 

Pathways for COL8A2 Recombinant Protein (H00001296-P01)

View related products by pathway.

PTMs for COL8A2 Recombinant Protein (H00001296-P01)

Learn more about PTMs related to COL8A2 Recombinant Protein (H00001296-P01).

Blogs on COL8A2

There are no specific blogs for COL8A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987
COL8A2 Antibody
NBP2-30020

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COL8A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COL8A2