COL19A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COL19A1 Antibody [NBP1-86215] - Staining of human cell line A-431 shows positivity in cytoplasm and cell junctions.
Immunohistochemistry-Paraffin: COL19A1 Antibody [NBP1-86215] - Staining of human urinary bladder shows strong membrane and cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL19A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLWQVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL19A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COL19A1 Protein (NBP1-86215PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COL19A1 Antibody

  • a1 chain of type XIX collagen
  • COL9A1L
  • collagen alpha 1 (Y) chain
  • collagen alpha-1(XIX) chain
  • Collagen alpha-1(Y) chain
  • collagen XIX, alpha-1 polypeptide
  • collagen, type XIX, alpha 1
  • D6S228E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001297-T01
Species: Hu
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBL1-16214
Species: Hu
NBP1-86456
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COL19A1 Antibody (NBP1-86215) (0)

There are no publications for COL19A1 Antibody (NBP1-86215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL19A1 Antibody (NBP1-86215) (0)

There are no reviews for COL19A1 Antibody (NBP1-86215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COL19A1 Antibody (NBP1-86215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL19A1 Products

Bioinformatics Tool for COL19A1 Antibody (NBP1-86215)

Discover related pathways, diseases and genes to COL19A1 Antibody (NBP1-86215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL19A1 Antibody (NBP1-86215)

Discover more about diseases related to COL19A1 Antibody (NBP1-86215).
 

Pathways for COL19A1 Antibody (NBP1-86215)

View related products by pathway.

Blogs on COL19A1

There are no specific blogs for COL19A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL19A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL19A1