COG6 Antibody

Images

 
Western Blot: COG6 Antibody [NBP1-84411] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: COG6 Antibody [NBP1-84411] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and golgi apparatus.
Immunohistochemistry-Paraffin: COG6 Antibody [NBP1-84411] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COG6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COG6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COG6 Protein (NBP1-84411PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COG6 Antibody

  • COG complex subunit 6
  • component of oligomeric golgi complex 6KIAA1134COD2complexed with Dor1p 2
  • conserved oligomeric Golgi complex protein 6
  • conserved oligomeric Golgi complex subunit 6
  • DKFZp313D191

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP2-47502
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP2-58437
Species: Hu
Applications: WB, ICC/IF
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-31735
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84411
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COG6 Antibody (NBP1-84411) (0)

There are no publications for COG6 Antibody (NBP1-84411).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG6 Antibody (NBP1-84411) (0)

There are no reviews for COG6 Antibody (NBP1-84411). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COG6 Antibody (NBP1-84411) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COG6 Products

Bioinformatics Tool for COG6 Antibody (NBP1-84411)

Discover related pathways, diseases and genes to COG6 Antibody (NBP1-84411). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG6 Antibody (NBP1-84411)

Discover more about diseases related to COG6 Antibody (NBP1-84411).
 

Pathways for COG6 Antibody (NBP1-84411)

View related products by pathway.

PTMs for COG6 Antibody (NBP1-84411)

Learn more about PTMs related to COG6 Antibody (NBP1-84411).
 

Research Areas for COG6 Antibody (NBP1-84411)

Find related products by research area.

Blogs on COG6

There are no specific blogs for COG6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COG6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COG6