CNTNAP3 Antibody


Western Blot: CNTNAP3 Antibody [NBP1-70503] - DU145 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CNTNAP3 Antibody Summary

Synthetic peptides corresponding to CNTNAP3(contactin associated protein-like 3) The peptide sequence was selected from the middle region of CNTNAP3. Peptide sequence GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CNTNAP3 and was validated on Western blot.
Theoretical MW
141 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CNTNAP3 Antibody

  • contactin associated protein-like 3


The specific function of this protein remains unknown.The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates. The protein encoded by this gene may play a role in cell recognition within the nervous system. Alternatively spliced transcript variants encoding different isoforms have been described but their biological nature has not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Mu

Publications for CNTNAP3 Antibody (NBP1-70503) (0)

There are no publications for CNTNAP3 Antibody (NBP1-70503).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTNAP3 Antibody (NBP1-70503) (0)

There are no reviews for CNTNAP3 Antibody (NBP1-70503). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNTNAP3 Antibody (NBP1-70503) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNTNAP3 Products

CNTNAP3 NBP1-70503

Bioinformatics Tool for CNTNAP3 Antibody (NBP1-70503)

Discover related pathways, diseases and genes to CNTNAP3 Antibody (NBP1-70503). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTNAP3 Antibody (NBP1-70503)

Discover more about diseases related to CNTNAP3 Antibody (NBP1-70503).

Pathways for CNTNAP3 Antibody (NBP1-70503)

View related products by pathway.

PTMs for CNTNAP3 Antibody (NBP1-70503)

Learn more about PTMs related to CNTNAP3 Antibody (NBP1-70503).

Blogs on CNTNAP3

There are no specific blogs for CNTNAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought


Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNTNAP3 Antibody and receive a gift card or discount.


Gene Symbol CNTNAP3