CNPY2 Antibody - BSA Free

Western Blot: CNPY2 Antibody [NBP2-84707] - Host: Rabbit. Target Name: CNPY2. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CNPY2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CNPY2 Antibody - BSA Free (NBP2-84707) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CNPY2. Peptide sequence: DGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNPY2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CNPY2 Antibody - BSA Free

• canopy 2 homolog (zebrafish)
• CNPY2
• HP10390
• MSAP
• MSAPprotein canopy homolog 2
• Putative secreted protein Zsig9
• TMEM4
• TMEM4CNPY4
• Transmembrane protein 4MIR-interacting saposin-like protein
• ZSIG9
• ZSIG9Cnpy2

Background

Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNPY2