CNOT7 Antibody - Azide and BSA Free

Western Blot: CNOT7 Antibody [NBP2-92571] - Analysis of extracts of various cell lines, using CNOT7 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

Immunohistochemistry-Paraffin: CNOT7 Antibody [NBP2-92571] - Immunohistochemistry of paraffin-embedded Human colon using CNOT7 Rabbit pAb (NBP2-92571) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CNOT7 Antibody [NBP2-92571] - Immunohistochemistry of paraffin-embedded Mouse brain using CNOT7 Rabbit pAb (NBP2-92571) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CNOT7 Antibody [NBP2-92571] - Immunohistochemistry of paraffin-embedded Rat brain using CNOT7 Rabbit pAb (NBP2-92571) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Product Discontinued

CNOT7 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human CNOT7 (NP_037486.2). PGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNOT7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:200-1:2000
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for CNOT7 Antibody - Azide and BSA Free

• BTG1 binding factor 1
• BTG1-binding factor 1
• CAF-1
• CAF1carbon catabolite repressor protein (CCR4)-associative factor 1
• CCR4-associated factor 1
• CCR4-NOT transcription complex subunit 7
• CCR4-NOT transcription complex, subunit 7
• hCAF-1

Background

CNOT7 is encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for CNOT7 Antibody (NBP2-92571)(1)

Publication using NBP2-92571

• Li CY, Liang Z, Hu Y et al. Cytidine-containing tails robustly enhance and prolong protein production of synthetic mRNA in cell and in vivo Molecular therapy. Nucleic acids Dec 13 2022 [PMID: 36320322] (WB, Human)

Bioinformatics

• Gene Symbol: CNOT7