CNNM1 Antibody

Images

 
Immunohistochemistry-Paraffin: CNNM1 Antibody [NBP1-89281] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts and strong positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNNM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNNM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNNM1 Protein (NBP1-89281PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNNM1 Antibody

  • ACDP1cyclin-M1
  • ancient conserved domain protein 1
  • Ancient conserved domain-containing protein 1
  • cyclin M1
  • Cyclin-M1
  • FLJ31632
  • metal transporter CNNM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-89280
Species: Hu
Applications: IHC, IHC-P
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00000904-Q01
Species: Hu
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-90272
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-54851
Species: Hu
Applications: WB
AF2988
Species: Mu, Rt
Applications: WB
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP2-57086
Species: Hu
Applications: WB, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CNNM1 Antibody (NBP1-89281) (0)

There are no publications for CNNM1 Antibody (NBP1-89281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNNM1 Antibody (NBP1-89281) (0)

There are no reviews for CNNM1 Antibody (NBP1-89281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNNM1 Antibody (NBP1-89281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNNM1 Products

CNNM1 NBP1-89281

Bioinformatics Tool for CNNM1 Antibody (NBP1-89281)

Discover related pathways, diseases and genes to CNNM1 Antibody (NBP1-89281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNNM1 Antibody (NBP1-89281)

Discover more about diseases related to CNNM1 Antibody (NBP1-89281).
 

Pathways for CNNM1 Antibody (NBP1-89281)

View related products by pathway.

PTMs for CNNM1 Antibody (NBP1-89281)

Learn more about PTMs related to CNNM1 Antibody (NBP1-89281).

Blogs on CNNM1

There are no specific blogs for CNNM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNNM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNNM1