CMTM6 Antibody (6K8M9)

Western Blot: CMTM6 Antibody (6K8M9) [NBP3-33308] - Western blot analysis of various lysates using CMTM6 Rabbit mAb at1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Western Blot: CMTM6 Antibody (6K8M9) [NBP3-33308] - Western blot analysis of lysates from Rat lung, using CMTM6 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 6K8M9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CMTM6 Antibody (6K8M9) Summary

• Description: Novus Biologicals Rabbit CMTM6 Antibody (6K8M9) (NBP3-33308) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1).
  
  Sequence:
  LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CMTM6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:2000 - 1:20000
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CMTM6 Antibody (6K8M9)

• chemokine-like factor super family 6
• chemokine-like factor superfamily 6
• Chemokine-like factor superfamily member 6
• CKLF-like MARVEL transmembrane domain containing 6
• CKLF-like MARVEL transmembrane domain-containing protein 6
• CKLFSF6
• CMTM6
• CMTM-6
• FLJ20396
• PRO2219

Background

The CMTM6 gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CMTM6