CMTM4 Antibody


Western Blot: CMTM4 Antibody [NBP1-84456] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunocytochemistry/ Immunofluorescence: CMTM4 Antibody [NBP1-84456] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84456] - Staining in human thyroid gland and lymph node tissues using anti-CMTM4 antibody. Corresponding CMTM4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84456] - Staining of human stomach shows strong cytoplasmic and membrane positivity in glandular cells.
Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84456] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84456] - Staining of human thyroid gland shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CMTM4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL
Specificity of human CMTM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CMTM4 Protein (NBP1-84456PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CMTM4 Antibody

  • chemokine-like factor super family 4
  • chemokine-like factor superfamily 4
  • Chemokine-like factor superfamily member 4
  • CKLF-like MARVEL transmembrane domain containing 4
  • CKLF-like MARVEL transmembrane domain-containing protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC

Publications for CMTM4 Antibody (NBP1-84456) (0)

There are no publications for CMTM4 Antibody (NBP1-84456).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMTM4 Antibody (NBP1-84456) (0)

There are no reviews for CMTM4 Antibody (NBP1-84456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CMTM4 Antibody (NBP1-84456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CMTM4 Products

Bioinformatics Tool for CMTM4 Antibody (NBP1-84456)

Discover related pathways, diseases and genes to CMTM4 Antibody (NBP1-84456). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMTM4 Antibody (NBP1-84456)

Discover more about diseases related to CMTM4 Antibody (NBP1-84456).

Pathways for CMTM4 Antibody (NBP1-84456)

View related products by pathway.

PTMs for CMTM4 Antibody (NBP1-84456)

Learn more about PTMs related to CMTM4 Antibody (NBP1-84456).

Research Areas for CMTM4 Antibody (NBP1-84456)

Find related products by research area.

Blogs on CMTM4

There are no specific blogs for CMTM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CMTM4 Antibody and receive a gift card or discount.


Gene Symbol CMTM4