CMIP Antibody

Images

 
Genetic Strategies: Western Blot: CMIP Antibody [NBP2-56410] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CMIP antibody. Remaining relative intensity ...read more
Immunohistochemistry-Paraffin: CMIP Antibody [NBP2-56410] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Orthogonal Strategies: Western Blot: CMIP Antibody [NBP2-56410] - Analysis in human cell lines A-549 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMIP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNH
Specificity
Specificity of human CMIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CMIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CMIP Recombinant Protein Antigen (NBP2-56410PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CMIP Antibody

  • c-Mip
  • KIAA1694c-Maf-inducing protein
  • T
  • TCMIP
  • tc-Mip
  • Truncated c-Maf-inducing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76567
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
AF5647
Species: Hu, Mu
Applications: WB, ICC
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87076
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84298
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
NBP3-04676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1133
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-97473
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CMIP Antibody (NBP2-56410) (0)

There are no publications for CMIP Antibody (NBP2-56410).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMIP Antibody (NBP2-56410) (0)

There are no reviews for CMIP Antibody (NBP2-56410). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CMIP Antibody (NBP2-56410) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CMIP Products

Array NBP2-56410

Bioinformatics Tool for CMIP Antibody (NBP2-56410)

Discover related pathways, diseases and genes to CMIP Antibody (NBP2-56410). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMIP Antibody (NBP2-56410)

Discover more about diseases related to CMIP Antibody (NBP2-56410).
 

Pathways for CMIP Antibody (NBP2-56410)

View related products by pathway.

PTMs for CMIP Antibody (NBP2-56410)

Learn more about PTMs related to CMIP Antibody (NBP2-56410).

Blogs on CMIP

There are no specific blogs for CMIP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CMIP