CMC2 Antibody

Images

 
Immunohistochemistry: CMC2 Antibody [NBP1-85289] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CMC2 Protein (NBP1-85289PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CMC2 Antibody

  • 2310061C15Rik
  • C16orf61
  • chromosome 16 open reading frame 61
  • COX assembly mitochondrial protein 2 homolog (S. cerevisiae)
  • DC13
  • hypothetical protein LOC56942

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-86786
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF2009
Species: Hu
Applications: WB, IHC
NBP1-85289
Species: Hu
Applications: IHC, IHC-P

Publications for CMC2 Antibody (NBP1-85289) (0)

There are no publications for CMC2 Antibody (NBP1-85289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMC2 Antibody (NBP1-85289) (0)

There are no reviews for CMC2 Antibody (NBP1-85289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CMC2 Antibody (NBP1-85289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CMC2 Products

Bioinformatics Tool for CMC2 Antibody (NBP1-85289)

Discover related pathways, diseases and genes to CMC2 Antibody (NBP1-85289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMC2 Antibody (NBP1-85289)

Discover more about diseases related to CMC2 Antibody (NBP1-85289).
 

Pathways for CMC2 Antibody (NBP1-85289)

View related products by pathway.

PTMs for CMC2 Antibody (NBP1-85289)

Learn more about PTMs related to CMC2 Antibody (NBP1-85289).

Blogs on CMC2

There are no specific blogs for CMC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CMC2