CMC1 Antibody

Western Blot: CMC1 Antibody [NBP1-86786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: CMC1 Antibody [NBP1-86786] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CMC1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CMC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CMC1 Protein (NBP1-86786PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CMC1 Antibody

• C3orf68
• chromosome 3 open reading frame 68
• cmc1p
• COX assembly mitochondrial protein homolog (S. cerevisiae)
• COX assembly mitochondrial protein homolog
• CX9C mitochondrial protein required for full expression of COX 1
• DKFZp779D0833
• MGC61571
• mitochondrial metallochaperone-like protein

Background

CMC1 is required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involvedin copper trafficking and distribution to COX and SOD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CMC1