CLPTM1 Antibody (6R4R8)

Western Blot: CLPTM1 Antibody (6R4R8) [NBP3-33544] - Western blot analysis of various lysates using at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6R4R8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CLPTM1 Antibody (6R4R8) Summary

• Description: Novus Biologicals Rabbit CLPTM1 Antibody (6R4R8) (NBP3-33544) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLPTM1 (O96005).
  
  Sequence:
  MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CLPTM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:100 - 1:500
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLPTM1 Antibody (6R4R8)

• cleft lip and palate associated transmembrane protein 1
• cleft lip and palate transmembrane protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLPTM1