We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CLOCK Recombinant Protein Antigen

Images

 
There are currently no images for CLOCK Protein (NBP1-88615PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CLOCK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLOCK.

Source: E. coli

Amino Acid Sequence: RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLOCK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88615.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLOCK Recombinant Protein Antigen

  • BHLHE8
  • circadian locomoter output cycles protein kaput
  • Class E basic helix-loop-helix protein 8
  • clock (mouse) homolog
  • clock homolog (mouse)
  • CLOCK
  • EC 2.3.1.48
  • hCLOCK
  • KAT13D
  • KIAA0334bHLHe8circadian locomoter output cycles kaput protein

Background

Circadian Locomotor Output Cycles Kaput (CLOCK) is a bHLH/PAS protein that plays an important role in the molecular clock mechanism. Specifically, CLOCK activates the central circadian loop by stimulating expression of Period and Timeless proteins. CLOCK has also been shown to interact strongly with other bHLH-PAS proteins such as MOP3, a BMAL1 isoform.

CLOCK levels peak during the late night and the early part of the subjective day. Mutations in CLOCK causes defective transcriptional activity and lengthens the circadian period, leading to abnormal circadian behavior.

CLOCK antibodies are useful tools for research on circadian rythmns, sleep biology and hormonal cycles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC,  IHC-P, KO, Simple Western, WB
NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC,  IHC-P, IP, WB
NB100-40853
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-87194
Species: Hu
Applications: WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
664-LI
Species: Hu
Applications: BA
H00004862-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86436
Species: Hu
Applications: IHC,  IHC-P
NBP2-83997
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NB100-2559
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1800
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-88615PEP
Species: Hu
Applications: AC

Publications for CLOCK Protein (NBP1-88615PEP) (0)

There are no publications for CLOCK Protein (NBP1-88615PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLOCK Protein (NBP1-88615PEP) (0)

There are no reviews for CLOCK Protein (NBP1-88615PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLOCK Protein (NBP1-88615PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLOCK Products

Research Areas for CLOCK Protein (NBP1-88615PEP)

Find related products by research area.

Blogs on CLOCK

There are no specific blogs for CLOCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLOCK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLOCK