CLOCK Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CLOCK Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLOCK.
  
  

  Source: E. coli

  Amino Acid Sequence: TQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CLOCK
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88614.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLOCK Recombinant Protein Antigen

• BHLHE8
• circadian locomoter output cycles protein kaput
• Class E basic helix-loop-helix protein 8
• clock (mouse) homolog
• clock homolog (mouse)
• CLOCK
• EC 2.3.1.48
• hCLOCK
• KAT13D
• KIAA0334bHLHe8circadian locomoter output cycles kaput protein

Background

Circadian Locomotor Output Cycles Kaput (CLOCK) is a bHLH/PAS protein that plays an important role in the molecular clock mechanism. Specifically, CLOCK activates the central circadian loop by stimulating expression of Period and Timeless proteins. CLOCK has also been shown to interact strongly with other bHLH-PAS proteins such as MOP3, a BMAL1 isoform.

CLOCK levels peak during the late night and the early part of the subjective day. Mutations in CLOCK causes defective transcriptional activity and lengthens the circadian period, leading to abnormal circadian behavior.

CLOCK antibodies are useful tools for research on circadian rythmns, sleep biology and hormonal cycles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CLOCK